google-site-verification=19ZaPV79MmcJFvp8EhMfMQUtJ1zb81y5F_KMLggItaQ
GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default Language Pack (us-en)
French FrenchDutch DutchGerman GermanFinnish FinnishCroatian CroatianItalian ItalianRomanian RomanianPolish PolishPortuguese BR Portuguese BRRussian RussianSpanish SpanishSwedish SwedishBulgarian BulgarianCzech CzechDanish DanishGreek GreekHungarian HungarianJapanese JapaneseJapanese JapanesePortuguese PortugueseNorwegian NorwegianSlovenian SlovenianUkrainian UkrainianTurkish TurkishVietnamese VietnameseThai ThaiHebrew HebrewArabic Arabic
0 items
New Products
Product Details
Warhammer 40K Space Marine Ultramarine Blue Helmet Keychain
Warhammer 40K Space Marine Ultramarine Blue Helmet Keychain
Warhammer 40K Space Marine Ultramarine Blue Helmet Keychain
Warhammer 40K Space Marine Ultramarine Blue Helmet Keychain
Warhammer 40K Space Marine Ultramarine Blue Helmet Keychain
Warhammer 40K Space Marine Ultramarine Blue Helmet Keychain
Notify me when product is back in stock
Brand:Warhammer 40K
Product Code:WHKK001
weight:120.0g
Product Condition:New
£16.79 inc. tax
£13.99 ex. tax
? Tax based on United Kingdom.
Add to Cart
Description
Warhammer 40K official licensed merchandise.  Discover the artefacts of the 41st millenium!  Also known as Adeptus Astartes, the Space Marines are super-human warrior monks who fight for the Imperium of Man.  Prepare for battle with these amazing metal 3D keychains featuring the Space Marines Ultramarines blue helmet.   Presented in window box packaging.
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i