google-site-verification=19ZaPV79MmcJFvp8EhMfMQUtJ1zb81y5F_KMLggItaQ
Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default Language Pack (us-en)
French FrenchDutch DutchGerman GermanFinnish FinnishCroatian CroatianItalian ItalianRomanian RomanianPolish PolishPortuguese BR Portuguese BRRussian RussianSpanish SpanishSwedish SwedishBulgarian BulgarianCzech CzechDanish DanishGreek GreekHungarian HungarianJapanese JapaneseJapanese JapanesePortuguese PortugueseNorwegian NorwegianSlovenian SlovenianUkrainian UkrainianTurkish TurkishVietnamese VietnameseThai ThaiHebrew HebrewArabic Arabic
0 items
New Products
Wallets
1 product(s) found for "Wallets"
Loungefly Disney Minnie Mous..
Add To Cart
Loungefly Disney Minnie Mous..
Loungefly WDWA2609 Minnie Mouse Birthday Celebration wallet. There is a front zipped compartment, two side pockets, top handle and adjustable straps. Made of premium faux leather. Measures approx 23cm x 29cm x 14cm. Loungefly Disney Minnie Mouse Birthday Celebration sparkly silver sequin mini fashion...
£46.79
Details Add To Cart
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i