google-site-verification=19ZaPV79MmcJFvp8EhMfMQUtJ1zb81y5F_KMLggItaQ
Product Added to your Cart
x

-------- OR --------

GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default Language Pack (us-en)
French FrenchDutch DutchGerman GermanFinnish FinnishCroatian CroatianItalian ItalianRomanian RomanianPolish PolishPortuguese BR Portuguese BRRussian RussianSpanish SpanishSwedish SwedishBulgarian BulgarianCzech CzechDanish DanishGreek GreekHungarian HungarianJapanese JapaneseJapanese JapanesePortuguese PortugueseNorwegian NorwegianSlovenian SlovenianUkrainian UkrainianTurkish TurkishVietnamese VietnameseThai ThaiHebrew HebrewArabic Arabic
0 items
New Products
SPECIAL OFFERS
Special offers with great price reductions!
1 product(s) found for "SPECIAL OFFERS"
Breyer 700242 Santa's Sleigh..
Sale
Add To Cart
Breyer 700242 Santa's Sleigh..
The 2021 Christmas Snow Globe is a reinvention of the traditional Santa Sleigh with Reindeer - instead it's Santa's Sleigh with Horses! Model 700242 Santa Sleigh Musical Globe has Santa with his sleigh and three Rein-horses stopping for a chimney delivery on a snow covered roof top! The base has relief...
£47.99 £29.99
Details Add To Cart
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i